PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10001990m
Common NameCARUB_v10001990mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 205aa    MW: 23572.5 Da    PI: 9.0715
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10001990mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.14.8e-191865148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd++l d+vk +G+g+W++Ia++ g++R++k+c++rw +yl
  Carubv10001990m 18 KGLWTVEEDKILMDYVKAHGKGHWNRIAKKTGLKRCGKSCRLRWMNYL 65
                     678*******************************************97 PP

2Myb_DNA-binding61.51.7e-1971116148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l
  Carubv10001990m  71 RGNFTEQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNTHL 116
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.951365IPR017930Myb domain
SuperFamilySSF466891.26E-3116112IPR009057Homeodomain-like
SMARTSM007172.6E-151767IPR001005SANT/Myb domain
PfamPF002495.0E-171865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-251972IPR009057Homeodomain-like
CDDcd001677.43E-122165No hitNo description
PROSITE profilePS5129428.73766120IPR017930Myb domain
SMARTSM007175.6E-1970118IPR001005SANT/Myb domain
PfamPF002491.8E-1871116IPR001005SANT/Myb domain
CDDcd001671.47E-1373116No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2773120IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048765Biological Processroot hair cell differentiation
GO:0090377Biological Processseed trichome initiation
GO:0090378Biological Processseed trichome elongation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MRKKVSNSGE EGNNEYKKGL WTVEEDKILM DYVKAHGKGH WNRIAKKTGL KRCGKSCRLR  60
WMNYLSPNVK RGNFTEQEED LIIRLHKLLG NRWSLIAKRV PGRTDNQVKN YWNTHLSKKL  120
GIKDPKTKQS NGADIVYQIN LPNPTDTSGE TKNSNIDDNN SILGDEIQED RQGSNYLSSL  180
WVHEDEFELS TLTNMMDFID GHCF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29181207108B-MYB
1h8a_C2e-291312022128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196230.0AY519623.1 Arabidopsis thaliana MYB transcription factor (At5g14750) mRNA, complete cds.
GenBankBT0263460.0BT026346.1 Arabidopsis thaliana At5g14750 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006288682.11e-151hypothetical protein CARUB_v10001990mg
SwissprotQ9SEI01e-142WER_ARATH; Transcription factor WER
TrEMBLR0H9F81e-151R0H9F8_9BRAS; Uncharacterized protein
STRINGAT5G14750.11e-140(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.11e-143myb domain protein 66